DPCstruct | MC41881
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 596 ± 35 aa |
| Standard deviation of domain lengths | 34.93 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 73.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 23.84 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | CL0020- CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L8D3K6 | 1-653 | MKMKISRNYVYYLKTSGVCVTVIGAGWFLYQLRQISRIVRSTVNTDVLNLEQTQAQYIYIDDPRFKNIFMFGKDEDLKESASEKPRS… |
| A0A2R8YD19 | 1-578 | MSLAAYCVICCRRIGTSTSPPKSGTHWRDIRNIIKFTGSLILGGSLFLTYEVLALKKAVTLDTQVVEREKMKSYIYVHTVSLDKGEN… |
| E2A031 | 13-619 | None |
| A0A084GCY7 | 508-1054 | None |
| A0A2A2JF88 | 646-1239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.