DPCstruct | MC4188
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 88 ± 11 aa |
| Standard deviation of domain lengths | 10.86 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M8W4F9 | 1-69 | MLFPAWFENVLGPAAPPGRADDWLYTATDVVLYRLLHGVDSPADALGPAPREQGHRRTLHERLVVECAE |
| A0A5R9FT20 | 1-97 | MSAGTKAERQLTTALSNRLADAVSARAVLPTWFVTVLGSAPPASGTQKWLETATQVLLYRLTYNVTDQVVALGSKPSDADRHRREWY… |
| A0A3D0R2X3 | 132-225 | None |
| A0A6B2DW62 | 47-141 | None |
| A0A1Q4YTE8 | 1-85 | None |
| A0A1Q4D6E1 | 182-272 | None |
| A0A1H9U4I2 | 191-280 | None |
| D3DBL9 | 32-124 | None |
| A0A5J6G874 | 8-106 | None |
| A0A1Q5I6P7 | 2-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.