DPCstruct | MC41879
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 345 ± 27 aa |
| Standard deviation of domain lengths | 27.05 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 23.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2B4SJR7 | 119-425 | REPILRLSDMKPGDHLLMTRNRGTSLEYAHHFLCSGKDEMSGKPKIIHYYNTPRNFMKQKFPTSLGSGSCLEQLGMIQEMALPDGDL… |
| A0A7S4DQ91 | 1-369 | SMGPTDHTAKASEESEGHETSQISFDESVTGKIRFWKDAPHITLYIDDYTVMEEVMDLTTLRRGDHCIVGLNPVRKLCGCCDALVFR… |
| A0A7S1XS95 | 38-380 | None |
| A0A812QFY3 | 23-400 | None |
| A0A812UI38 | 23-397 | None |
| A0A813GE61 | 80-453 | None |
| A0A0M0JU64 | 17-341 | None |
| A0A8B6GEQ5 | 115-453 | None |
| A0A6J8CV91 | 33-363 | None |
| A0A7S4DQ71 | 13-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.