DPCstruct | MC41877
Metacluster Properties and Pfam Annotations
| Number of structural domains | 131 |
|---|---|
| Mean domain length (aa) | 98 ± 11 aa |
| Standard deviation of domain lengths | 10.87 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.47 |
| Pfam Score | 97.73 |
| Assigned Pfam label(s) | PF09951- PF10077 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y7WQA8 | 6-109 | QAVCLRLDMDFFECDPNHKIGISLNVKDRLRPLNGMRIKPESGTCGWYIWAGEVFSEASDFFVPLHVSHVESWEPLLLPYLGLPPGS… |
| A0A2W2BFF5 | 2-90 | GGCVATDRITVDGNRVGYMCRTEPINDLDSGWQFLAGDESQEYVDVADNSGVYDVNTIANYDPEIIPFLHFPIGSEFERDEVSGNLT… |
| U2JAL4 | 24-134 | None |
| A0A1E3AZU3 | 331-444 | None |
| B8FIW8 | 1-99 | None |
| A0A4Q2X938 | 6-96 | None |
| A0A496PKG5 | 13-124 | None |
| A0A0Q5W5X5 | 3-97 | None |
| A0A517SQB3 | 121-223 | None |
| A0A4R7ZF20 | 58-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.