DPCstruct | MC41874
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 119 ± 16 aa |
| Standard deviation of domain lengths | 16.15 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 43.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7E4W633 | 1-121 | MRNFLPFLTGADDRTVRAFHDVLNDDDVPSEGRRQELIHVLAVSYLNAEQLEHFNAWSTSRRKKLRAREEQLKGLSFGARDALKKLV… |
| A0A811KNG8 | 541-664 | YEPIDSALPFLQGASPVVQRVFKEVLNDPDVLSEGKRQDEIHVLAVSYLNPEQLEIFNDWSLARRKRIQQREERLYPLSRPARTALK… |
| A0A0N5A8H8 | 79-171 | None |
| A0A183UB92 | 177-290 | None |
| A0A0N5CVT1 | 32-151 | None |
| A0A7E4W7P0 | 196-343 | None |
| A0A1I7SQS6 | 316-436 | None |
| A0A183HZX0 | 136-232 | None |
| A0A044TP39 | 160-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.