DPCstruct | MC41873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 600 ± 108 aa |
| Standard deviation of domain lengths | 108.05 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 74.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.20 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 18.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0724 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I0ZB08 | 14-562 | REMNRASALQAELLQAQQAKRDADFGRERAEADQAEAAATAKRATQSLERKITVLEGQLANAASQAEESCQSLAAELRQARLQADQE… |
| A0A7E4VUE5 | 32-565 | GSSADLDTQKKIRELTLELAETKSALAEQRKLLDLTSAEAKELRISKKDIYTRYERLRKEAETLHNELDRLKKIEREFNEKKASSEF… |
| A0A226EUJ7 | 100-770 | None |
| A0A540MBB5 | 475-1089 | None |
| A0A7N9CHS4 | 24-647 | None |
| A0A397AHI0 | 265-934 | None |
| E4YGE0 | 12-527 | None |
| A0A0N5AMM0 | 13-518 | None |
| A0A7C8P9Z9 | 477-1102 | None |
| A0A4U0XD76 | 15-708 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.