DPCstruct | MC41870
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 174 ± 31 aa |
| Standard deviation of domain lengths | 30.80 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 74.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.27 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01391 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G6QBN9 | 17-188 | IAGSCKKGDTGAAGPVGEPGARIYSGTGIPEAALGKTGDFYFDTEARAMYGPKSKEGWGNPVSLVGATGPQGEPGSIIIHGSGIPDA… |
| A0A3E0MQX5 | 1-137 | MSVQILSRRSSVLRDRPFPTRLGDGELAINTNAGEPGLFVKDSGSGLIKAGPTFVGATAPNASGVGFTSSSKGESWLDTASTHILKI… |
| A0A2N3AFL1 | 275-476 | None |
| A0A239N6C6 | 53-229 | None |
| A0A1M7JFD0 | 36-261 | None |
| A0A2E0DSF0 | 2-145 | None |
| A0A4Q8AHQ8 | 81-240 | None |
| A0A7Z9CFV7 | 120-309 | None |
| A0A2E3DFV2 | 199-366 | None |
| A0A1R3W016 | 33-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.