DPCstruct | MC41866
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 141 ± 19 aa |
| Standard deviation of domain lengths | 19.20 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 73.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 61.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G7INW9 | 595-695 | VDVNVGRIVVRLGWVPLQPLPESIQIHNLEQFPDPIKIQQYLWPRLCKLDHHTLYELHYQLITFGKVFCTKRNPNCNACPMKDNCKY… |
| A0A151QZD4 | 281-418 | VDINVARIVVRLGWVPLQPLPEYIQLHNLEMFPDSNKIQQYLWPRLCTLDRDTLYELHYQLITFGKVFCTKKKPNCNACPLRGDCKH… |
| A0A2Z6MQY8 | 342-473 | None |
| A0A1D6QN83 | 1469-1630 | None |
| A0A835RAQ4 | 587-735 | None |
| A0A835PG28 | 91-251 | None |
| A0A1Y1IJ14 | 286-408 | None |
| B8A274 | 66-227 | None |
| A0A067DR76 | 676-837 | None |
| A0A314ZQ10 | 562-678 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.