DPCstruct | MC41863
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 143 ± 17 aa |
| Standard deviation of domain lengths | 17.18 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A445B9N3 | 2-143 | LKNIPTRAEINDKKRVCRSNCRETLNLILNWTLDKRAILGYYPINKEQLTKLVIFPEASPSDTYQFFQYGLIDTILIFDNLNIIKKF… |
| A0A6S7N7G3 | 1-139 | MKNHLPKNFPNYGDSLISYTEVHSLMGFYQVARRPGPKAVFLADLSDPMTLWDYFIHGFINTIYLEGTNLHCISEFPSAVQIIIRNY… |
| A0A3N7H2X8 | 187-315 | None |
| A0A445B566 | 65-186 | None |
| A0A5N6PI39 | 185-337 | None |
| A0A445DG81 | 70-227 | None |
| A0A2U1PM36 | 478-644 | None |
| A0A2I0HJD9 | 258-403 | None |
| A0A445ECF2 | 116-229 | None |
| A0A699I229 | 163-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.