DPCstruct | MC41862
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 174 ± 11 aa |
| Standard deviation of domain lengths | 10.61 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0111 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G0DX84 | 1-190 | MNWILITFQWYLVLLIIGIIFTPLTKKIFKNFNFDFGYPFAKTLGIILLSYFVFVLGIVKILPFSRLSLIFALCLFAIINWFIFKKN… |
| A0A136KH09 | 2-175 | TWLTISLLWYFKLVVLGIVFLPITIAFFGDRLVDKGYAFSKVVGILLCSFTLFVLGVFKIAPFTVISAFTVFGGFAIINMIVAKKVI… |
| A0A284VK37 | 1-149 | None |
| A0A7C2EYM8 | 3-175 | None |
| A0A2H3L392 | 214-395 | None |
| A0A832CQ94 | 618-794 | None |
| A0A7C4KH22 | 4-173 | None |
| A0A7C4KFU1 | 202-382 | None |
| O29673 | 1-156 | None |
| A0A2U2S9Q5 | 388-560 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.