DPCstruct | MC4186
Metacluster Properties and Pfam Annotations
| Number of structural domains | 394 |
|---|---|
| Mean domain length (aa) | 183 ± 31 aa |
| Standard deviation of domain lengths | 30.57 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.51 |
| Pfam Score | 92.24 |
| Assigned Pfam label(s) | PF02769- PF02142- CL0063- PF21553- CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G8FLD8 | 7-177 | SNFEALAQAIQAGTLNARIQRLVVNNPGCGAQQRAERLGIPVSVLDHRLIKDRRKLDGELVRLFRADQVELVVMAGWMRIVTEVLIS… |
| A0A1G1ZSI4 | 4-165 | LLLGSDNSECEELRRYLFSCGEEVIFSAEKITSEKVREINPDIIISYNYRHILKEDVFLMPILGTINLHISYLPWNRGADPNFWSHL… |
| A0A7C1AIN5 | 6-118 | None |
| A0A4R5AES5 | 260-477 | None |
| A0A2I0GM38 | 40-240 | None |
| A0A554KCB6 | 1-214 | None |
| A0A379USD6 | 147-317 | None |
| A0A0K2MEG0 | 7-191 | None |
| A0A522EPJ5 | 9-226 | None |
| A0A6A6L4K4 | 22-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.