DPCstruct | MC41857
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 115 ± 10 aa |
| Standard deviation of domain lengths | 9.50 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 45.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812AT60 | 71-200 | TSSARSLDMTQEDEFRVFEIPGLKPKEAQRAKKRRRKEVPPPRYHKMKVTDDWTNIWPSASTFKHSAIPFPVRQGFIKRLNENEGIP… |
| E9GBI0 | 3-106 | SIVNLRDVFSVIFSRDDEFRSLDLSPNKSLNMRSYGRKVYKRAAVHPPHSNKMPTDEDWPSVSPVARSFHPASFPLPLHQDRVVPGA… |
| H3AA17 | 32-141 | None |
| A0A834JRP3 | 30-134 | None |
| A0A7R9HV67 | 1-116 | None |
| A0A4X1V1U9 | 200-310 | None |
| A0A2J8WBW5 | 1-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.