DPCstruct | MC41853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 83 ± 6 aa |
| Standard deviation of domain lengths | 6.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 38.45 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0023- PF06807 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S2R706 | 16-92 | VVERSNKFRSESREASIREYFYGSPRNVLHPHTCEVRFSDIKVYRIGAPPIPNTLMPLDMQKTDLETKLEPVTPGLN |
| E9FZ60 | 1-80 | VVERSRQARIESRDQKIREYFYGSAAKFYPHSFEVRFSDVKIFKIGAPALPDSLMPLGMKAEDQLTKLVTVQPSIDFLFN |
| A0A6H5KLD2 | 289-379 | None |
| A0A6S7J756 | 144-219 | None |
| A0A6G3MFQ9 | 75-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.