DPCstruct | MC4185
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 132 ± 7 aa |
| Standard deviation of domain lengths | 6.67 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13981 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379WS42 | 232-371 | INSLPDKYRQEKVRAMEDLVKSFRSGRLSEARIRPVESSLVSVLAHPPYTQSALISEWLGPVQERFFAHQCQTYNDVPLPAPDTYYQ… |
| A0A7D6HPJ8 | 3-129 | IASIDKMYDVAKIDMIKQIISSLTKQKVDTSTIEVSLIDILVEQPYYADTEISNWLKSVCINYIGKFNDWPMSLQKDSVINLMIDTF… |
| A0A193QKV8 | 2-123 | None |
| E0WT68 | 216-341 | None |
| A0A447N883 | 44-182 | None |
| A0A380PPK4 | 496-622 | None |
| A0A4P7L1N0 | 63-191 | None |
| A0A4P7L1B3 | 299-427 | None |
| A0A447M6U6 | 145-284 | None |
| G5QL37 | 360-499 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.