DPCstruct | MC41847
Metacluster Properties and Pfam Annotations
| Number of structural domains | 179 |
|---|---|
| Mean domain length (aa) | 211 ± 40 aa |
| Standard deviation of domain lengths | 39.98 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.39 |
| Mean intra-cluster sequence similarity (%) | 11.18 |
| Pfam Score | 27.89 |
| Assigned Pfam label(s) | PF19674- PF19378- PF15579- PF11876 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A410WU39 | 67-281 | GGKHVKEISLTLFTYQVFNKQNIAKSVFDSLSENGFLFTKMGVTEPLKVRYSREEAISLWCSETEGCYDIELEKMVGKAGNFMAKGP… |
| A0A2G0Y7L9 | 2-207 | DRMSQIGAPLGFAGLELPATPSCDDGLVATYTVKLPIRGLRCVGDYAYRGDRYIYEDRASYDEHLRFGFKISNKAIDYKLVVNEHLP… |
| A0A4S8PXN0 | 1-191 | None |
| A0A829Y587 | 1-236 | None |
| C7NTL1 | 7-206 | None |
| A0A1M7DWR0 | 2-214 | None |
| A0A2V3X4R3 | 18-271 | None |
| A0A0Q7XJ15 | 2-154 | None |
| N8W7N8 | 8-201 | None |
| Q0B2G5 | 20-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.