DPCstruct | MC41845
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 175 ± 35 aa |
| Standard deviation of domain lengths | 35.23 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 81.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 20.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0436 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G3YEA8 | 134-281 | VANLDDAQVGGIEKVVGILNISPRAVEKNVIESLERSKPELAEDIKRNMFVFEDIVLLDDEAIRAVVDRVDARDLLVAMKPVSDALR… |
| A0A539EP17 | 1-117 | MKAKRELLRLLEGRDPELYALVRSRVLLFEDVAFLEARDWSMVMGTVSLEQWSAALHEGEERVRDGLRAQMLPKTWAILEQMIAGTR… |
| A0A258TS93 | 675-870 | None |
| A0A840SAX0 | 248-451 | None |
| A0A838EWW7 | 103-305 | None |
| A0A0S7Z8D6 | 266-413 | None |
| A0A852VGH5 | 7-102 | None |
| A0A1F9TTC3 | 275-470 | None |
| A0A1A9X6M4 | 568-742 | None |
| A0A484X5N9 | 130-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.