DPCstruct | MC41844
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 303 ± 57 aa |
| Standard deviation of domain lengths | 56.59 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z0GIU7 | 373-636 | RRLPRPGRSPDPQSWCLIAARAPSAHNTQPWEPQLLDDGAEPRIELTVDPARTLPVGDPDHRDLHLSLGAWIESFAVAAAAEGQQVR… |
| A0A2H0TR66 | 1-344 | MKDIIEKVIAEGICAPSGENKQPWEFYIREDGFDVYNLPNRDVSLYNYAQQGSLMAHGALIENVVLSANANGYEAHIQLFPNHQNEN… |
| A0A4R2V436 | 6-254 | None |
| A0A3L7PIM6 | 29-319 | None |
| A0A7Y3P580 | 582-950 | None |
| A0A1Z1WQB7 | 11-195 | None |
| A0A2V7XUB3 | 100-423 | None |
| A0A158J175 | 9-329 | None |
| A0A3B9EY57 | 134-531 | None |
| A0A426H612 | 202-487 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.