DPCstruct | MC41839
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 95 ± 9 aa |
| Standard deviation of domain lengths | 8.61 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 40.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453EHY9 | 36-121 | GNWLLPFAGQAYFDAELEAWVGLARDKESSGYLCSCDVPPVAAKLTSPPSWKLGQDKMFSKDSELHRGAKLVYMGDSKFCLIESLF |
| A0A3B6NND1 | 2-95 | WQLPFTGRGYFDPELDAWVGLSAQLDTIGHICSCDVVSTNSGTSHQQCPAMKVGKENLFSEFPDERHIGATLVYTGGESKLCLLEVI… |
| A0A446KQ83 | 216-307 | None |
| A0A4U6SVT5 | 79-170 | None |
| A0A0D9WXF1 | 232-326 | None |
| A0A835FBX1 | 1-98 | None |
| A0A453I9Q5 | 51-154 | None |
| A0A0D9WX15 | 212-309 | None |
| A0A3L6T701 | 236-330 | None |
| A0A1E5VHH1 | 6-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.