DPCstruct | MC41834
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 167 ± 26 aa |
| Standard deviation of domain lengths | 26.38 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 65.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 37.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6QUN6 | 17-203 | VLVPGSPTGIAMGNGNSTQKHVRTDKLEVCREFQRGNCTRGENDCRYAHPMEAAMVDGSENSVIVCMDYIKGRCTRDKCKYFHPPAH… |
| A0A556UXS7 | 1-120 | MAVNIAVGRDTKWLTLEVCREFQRGSCSRSDTECKFAHPSRTCHVENGRVIACFDSLKGRCTRDNCKYLHPPPHLKTQLEINGRNNL… |
| A0A6L5CG74 | 20-172 | None |
| A0A4U5MWA7 | 32-190 | None |
| A0A7R8CPP9 | 1-189 | None |
| A0A6V7XQ69 | 42-208 | None |
| A0A0N4W9P0 | 14-220 | None |
| A0A154PKL1 | 3-144 | None |
| A0A7R8X0V4 | 4-159 | None |
| A0A7R9KUJ9 | 37-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.