DPCstruct | MC4183
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 113 ± 16 aa |
| Standard deviation of domain lengths | 16.24 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 43.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19060 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2MYX1 | 41-141 | REEQAQRRRIMKIRRAVMAGKAKRTPGGLTADDLVINKRGKLVSRAASEHGKIKYVKSLKAWIDAVTAARAELNITGFVAVNGRTPE… |
| A0A7S3M7E6 | 6-110 | KKAMKAMKVSKIAKGPRAKVSVFLGGKEKTSSGLTKAALTKSKTGRIVSKKKSAVGKKNYAGSKAKAWVDACKAARKALGLTGFVPV… |
| A0A6C0CL95 | 3-94 | None |
| A0A812N155 | 72-186 | None |
| A0A813BPS9 | 10-129 | None |
| A0A6C0I7U7 | 3-101 | None |
| A0A813GWP4 | 443-540 | None |
| A0A812RTG6 | 352-475 | None |
| A0A7S2M0B7 | 67-176 | None |
| A0A812PMT2 | 269-386 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.