DPCstruct | MC41828
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 133 ± 8 aa |
| Standard deviation of domain lengths | 8.07 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 25.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A232LXZ8 | 399-527 | VWTTEPELRLENGVMKISRMKNDPSMNKRYMSNRRSIHAHANLQRSNIRVMKPGDTHELFIETRKPEQDASWTRVQVSYSTSTALKV… |
| A0A370PCM5 | 1-117 | MVRVQPQAEQNDRYNSFRRPIMRETTLGTNDLRLEYGGAYVLREKHDAPEPHKDYRTVQVEYSLLSATKANDGYYFLCLGIYQDTCE… |
| A0A1S8A869 | 49-187 | None |
| A0A4Z0Z1M2 | 53-193 | None |
| A0A559MKG8 | 277-417 | None |
| A0A229XC38 | 536-670 | None |
| A0A4Q4Y693 | 198-326 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.