DPCstruct | MC41823
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 69 ± 7 aa |
| Standard deviation of domain lengths | 7.35 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 56.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04997 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1UGV5 | 1-69 | MDELENFDKMKIGIASDEKIREWSHGEVKKPETINYRTLKPEKDGLFCERIFGPTKDWECHCGKYQKSK |
| A0A847MBY7 | 6-65 | DLGAMQIGLSSPEQIRKWSRGEVKKPETINYRTLKPEKDGLFCEKIFGPTKDWECYCGKY |
| A0A2X1PMS7 | 3-76 | None |
| A0A2E0TQH8 | 545-621 | None |
| A0A7G0X258 | 1-81 | None |
| C6V5G3 | 16-79 | None |
| A0A835KK92 | 1-82 | None |
| A0A2C9VZI1 | 8-88 | None |
| A0A094P9Z8 | 12-81 | None |
| A0A381KMK2 | 1-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.