DPCstruct | MC41822
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 191 ± 26 aa |
| Standard deviation of domain lengths | 26.03 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.92 |
| Pfam Score | 94.74 |
| Assigned Pfam label(s) | CL0023- PF17760- PF17755 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1U812 | 33-232 | FEELTPRMFSFNNPFGACPECTGIGYLMRIDEDLIIPDKDKTLYDGVKAFGASTMKKGDTMAKMYFESIAKHYGVKIKDVPIKKLPK… |
| A0A1H2AY88 | 13-225 | ACPSCGEIHRALGKADYSYNTPSGACKSCSGLGSIVDIDIEAVFDRSKSIRGVAVAFWFEALAEYNASILAAAGKHYGLPMNTSQPV… |
| A0A5C8DXN9 | 656-840 | None |
| A0A0G1V041 | 297-496 | None |
| A0A4P5P9R8 | 103-320 | None |
| A0A3M2W0Q4 | 503-729 | None |
| A0A4P6ZZJ1 | 2-205 | None |
| A0A0C2MFT4 | 511-693 | None |
| A0A2R5EYQ7 | 3-109 | None |
| A0A6F8XZY1 | 154-347 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.