DPCstruct | MC41820
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 119 ± 13 aa |
| Standard deviation of domain lengths | 12.71 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0K8X5 | 4-111 | GYRVRDEISFYMIYNELNGLMDFDEAMDLEILQKILPRIHGSSISIKKILVELFKICSGNYEAKYEYEDMDVSDKMLKDMDNCVYPR… |
| A0A832RP98 | 1-120 | LRDDLGMIWDELVAELDFFHKTLKGPGFDFGFRVTMEILRFMHAAWVYDGRPRKWDNWERYMDAQIKQKILPKIHGPERLLRDTLED… |
| A0A076LHJ8 | 472-599 | None |
| A0A2N5K150 | 460-569 | None |
| A0A2W1L0X6 | 17-127 | None |
| A0A7K1UEN5 | 367-484 | None |
| A0A4Y8PIA6 | 572-692 | None |
| A0A372LJ13 | 565-678 | None |
| A7C6V3 | 26-154 | None |
| A0A429Y777 | 631-743 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.