DPCstruct | MC4182
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 85 ± 9 aa |
| Standard deviation of domain lengths | 9.16 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.89 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4QYE7 | 156-235 | GGYIPVPGPRSPSRDGSPSNDWIFNMLVDREKFRIKRDFAEADRIRDELRQKGVDILERERRWQHKDGRSGARPNADDKK |
| A0A7S4SKM2 | 297-371 | ADGAAALVGSSGPSTAWINNRLIEREKARLDRNFDEADKIRAELRQRGVEVDDRLRTWSSRDGRRGHRPNHNDIP |
| A0A7S3Z9B0 | 74-156 | None |
| R1D7D9 | 20-119 | None |
| A0A0M0LSG6 | 650-725 | None |
| A0A812RLZ8 | 1-86 | None |
| A0A7S4B4E0 | 5-96 | None |
| A0A6S9VRR8 | 34-135 | None |
| A0A7S0HT92 | 57-146 | None |
| A0A7S2F0I3 | 101-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.