DPCstruct | MC41817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 63 ± 3 aa |
| Standard deviation of domain lengths | 2.66 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 89.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 65.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A286XU72 | 1-68 | AADLSKPIDKRIYKGTQPTCHDFNHLTATAESVSLLVGFSAGQVQLIDPIKKETSKLFNEESMLRYSL |
| A0A0A6YX87 | 82-144 | RKAADLSKPIDKRIYKGTQPTCHDFNLLTATAESVSLLVGFSAGQVQLIDPIKKETSKLFNEE |
| A0A6I9VPB3 | 91-153 | None |
| A0A2A2K1W6 | 137-200 | None |
| A0A2K5HIH3 | 35-92 | None |
| A0A3Q0EEU9 | 40-100 | None |
| A0A1Y3BL65 | 33-94 | None |
| A0A2R8QBM9 | 40-100 | None |
| A0A811JUB0 | 163-226 | None |
| A0A3N0Z8N4 | 699-759 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.