DPCstruct | MC41807
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 176 ± 32 aa |
| Standard deviation of domain lengths | 32.34 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 26.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W9VL35 | 1-183 | MAKVRLSNLERRRLREECRELLSKHIGIKVHPSQVRLMPKSSDPYRWKIMPEKEEALSGLFSKNISDHSIRAYRELCEGVDKTFEAV… |
| A0A5N6YVG2 | 1-167 | MDEQSTPLGNQKRAFWRSSCRERLSQHIWETLGLKVQPSDVRLKPEEDMPYRWRIEDPCLEYLFQKYLSKHSVGAYMLLQREVGQKK… |
| A0A094HZY9 | 723-911 | None |
| A0A3N4IFF3 | 1-266 | None |
| A0A1L9SYT8 | 1-140 | None |
| A0A5N6E652 | 1-106 | None |
| C4K0A9 | 148-335 | None |
| W9NJ00 | 10-217 | None |
| A0A093YMM9 | 93-299 | None |
| A0A2V1B2U4 | 1-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.