DPCstruct | MC41806
Metacluster Properties and Pfam Annotations
| Number of structural domains | 595 |
|---|---|
| Mean domain length (aa) | 366 ± 87 aa |
| Standard deviation of domain lengths | 87.44 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 85.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 13.09 |
| Pfam Score | 94.19 |
| Assigned Pfam label(s) | CL0023- CL0270- CL0479- PF06226- PF10283 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A158R4G8 | 13-406 | SFTVPASSIHIIDTPEEFYNCLLELAKNVRNRITLSTLYIGDGPLEQAFVEQLRKSINDNSDLSLEILIDYFRGTRGGEKSSVALLK… |
| A0A160SYZ4 | 203-589 | PAVITATAALTIAVAPDNAYAVIARAVRAADTSIRLASLTLENMPLAEELAAAARRGVTVTALLEGGPPGGLTDQERAACRIIESAG… |
| A0A3E1ET85 | 364-693 | None |
| A0A2H0P7H8 | 103-458 | None |
| A0A226RWG7 | 13-312 | None |
| F8CQW7 | 306-756 | None |
| A0A162KT02 | 391-717 | None |
| A0A553ML49 | 49-611 | None |
| A0A3E1ESA8 | 125-408 | None |
| A0A182TNC9 | 373-803 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.