DPCstruct | MC41805
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 120 ± 18 aa |
| Standard deviation of domain lengths | 18.43 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 17.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3T0VJV3 | 38-186 | TQLRYKIPKDHAFPLNSKALSEALIDVPQYSELSAIFRFGDEYSLSSYRYRLRMQEPVTILKATYSRLRTRHSSPNKFIVQGLYEPK… |
| A0A3B8K6U2 | 1-136 | MINSISKDKIPKNCGYVLSSDQLNTLLAENNITIHTDLIYYYSKVPGQLLYAYYSFPNDHIPYYRIYIQSGTVLRREIKNAKKVVSD… |
| A0A7K2LJ35 | 3-105 | None |
| A0A0J6XLC2 | 14-135 | None |
| A0A543CNE8 | 78-205 | None |
| A0A841CWV5 | 1-115 | None |
| N1UKA4 | 3-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.