DPCstruct | MC41802
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1216 |
|---|---|
| Mean domain length (aa) | 196 ± 41 aa |
| Standard deviation of domain lengths | 40.62 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 16.51 |
| Pfam Score | 95.04 |
| Assigned Pfam label(s) | CL0023- CL0063- CL0071- CL0083- PF02417 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A357T640 | 18-204 | SVRTGQAMKTKFCLVRHGSTDWNIEGRIQGCTDTTLNQQGRREVSELAQSLKRQDWEFIITSELQRAKETGEIISDTLQIPLFSYKG… |
| S9UPA2 | 3-180 | QIYVCRHGQDMDNVAGILNGHRDEPLSALGKSQAAALAQKVKDEQLQLNAIYTSPLRRAKETAEEVGRSTGVPVVVMADLIERDFGV… |
| A0A843DD51 | 183-368 | None |
| A0A0K9QRR2 | 8-208 | None |
| A0A1I5VB94 | 3-178 | None |
| A0A6G0XX30 | 336-548 | None |
| A0A6G0XVJ5 | 5-186 | None |
| A0A6G0XV57 | 22-243 | None |
| A0A166C816 | 826-1032 | None |
| A0A1S8VY87 | 181-380 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.