DPCstruct | MC4180
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 119 ± 11 aa |
| Standard deviation of domain lengths | 10.54 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 22.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R1F0X8 | 43-165 | QQMSAAQQQQMQQMQQQQAQQQAAQQQQMQQQQQQQQQQQQAQQQAAAQQQQQQQQQQQQQQGGGMPGQQPGQQPMQLMLVNVPPNV… |
| A0A7S3HID9 | 1-117 | KTHDLCEDDLGSMLEQARLRGDGEGDAAVGALLGMLDYQPWIGNIFVLKRLSDEAFAAAAASSPGTEATPPLSLRVAVPEGVQPGQE… |
| A0A7S1DMG6 | 5-111 | None |
| A0A448ZGK5 | 375-515 | None |
| A0A7S2G2S6 | 44-153 | None |
| A0A6U2IBT4 | 13-139 | None |
| A0A7S0ZLS8 | 23-150 | None |
| A0A7S3HJ01 | 19-129 | None |
| A0A813HL18 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.