DPCstruct | MC418
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 217 ± 27 aa |
| Standard deviation of domain lengths | 26.84 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2U2Y3 | 5-174 | NRLKEFLPRTGMVFPSANLVLGARRKDTGVMKAFEVANFAEVRGGPTKTAKAAVDQALAETFTLALDPQIFKHLTTEGEGLFDFLGA… |
| A0A1Y2X804 | 5-205 | RASTKKTTWKSLRTVLPDTGMDYPRTRYLLSQPRRDDSVVTELEKAGLIPKGTPNICSTKTLDEALAHMFTLALRPEIKKYLTGQQG… |
| A0A446B9L6 | 44-228 | None |
| A0A3S4D862 | 19-279 | None |
| A0A1W2TJQ3 | 4-197 | None |
| A0A1J7JW51 | 1-266 | None |
| A0A1J7JLI6 | 2-194 | None |
| A0A1J7J4I3 | 1-217 | None |
| Q2H5L6 | 51-298 | None |
| A0A4Q4USK3 | 1-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.