DPCstruct | MC41796
Metacluster Properties and Pfam Annotations
| Number of structural domains | 158 |
|---|---|
| Mean domain length (aa) | 120 ± 20 aa |
| Standard deviation of domain lengths | 19.87 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 91.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.83 |
| Pfam Score | 84.98 |
| Assigned Pfam label(s) | PF10589- CL0344- PF00499- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X6KHZ6 | 89-216 | VPCVRGEKMRDAIMDFDYLRGELGSGLGTAAVIVMDKQTDIIKAIWRLSKFYKHESCGQCTPCREGTGWMMRVMDRLVRGEAELEEI… |
| M9M1P9 | 548-680 | VPILPKHKCEEVLMDFDSLRENQSSLGTGAVIVMDKSTDVVQAISRFAKFYKHESCGQCTPCREGTTWLANMMERFEEGRGNNREID… |
| A0A6G3V3I2 | 2-83 | None |
| R6H7R0 | 32-129 | None |
| A0A504X706 | 400-533 | None |
| A0A6A6KX24 | 139-243 | None |
| A0A3D1R6E8 | 3-135 | None |
| A0A090MT50 | 609-738 | None |
| A0A7Y7NWV5 | 115-233 | None |
| A0A7V4N2J6 | 2-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.