DPCstruct | MC41794
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 437 ± 76 aa |
| Standard deviation of domain lengths | 75.58 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U0R8R6 | 92-519 | VLKETLAIIDESNEWAKTKTDSARVVAERQLAFALRAFHMVAGINSIHDLTLEQFEAFIKPLRTADDRWKDDIDANKQKALRSIAIV… |
| A0A327Q7R6 | 3-427 | RQKGKKNDGRKSNLTFSWMLDTLGPEWQQWQAFAAEWMSKQNTSISDKQKSLTRFFESYLLICAPYAIDVNLFFKGHNGHHCSTEEL… |
| A0A1C3JJ30 | 13-415 | None |
| A0A6P2RSC4 | 68-506 | None |
| A0A416F974 | 3-462 | None |
| A0A254UIE9 | 187-883 | None |
| A0A2S5ITC0 | 2-358 | None |
| A0A2C8ZNE9 | 34-434 | None |
| A0A2N0DTE2 | 1-300 | None |
| N9MUQ4 | 16-471 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.