DPCstruct | MC4179
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 151 ± 10 aa |
| Standard deviation of domain lengths | 9.99 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0FCC0 | 218-362 | GPLTLSALGQAVSSTFCGACLLGVVSAGGASGPAEMAILQAHLPGVPTWWSGPGVVTSPLVRGCGNNVKHICASGIRAWYEQHRHVK… |
| A0A7S1LLJ9 | 110-250 | LSALGRAGVSSTFCGACKLGVISAGSGGGGDMRGRICGGVLGGRAGCSWSGPGASSPLIVGCHDSHKAACAHGIRAWYKHRGTYIPR… |
| A0A7S2QP68 | 259-396 | None |
| A0A812JRX6 | 303-464 | None |
| A0A7S2KTI9 | 102-264 | None |
| A0A1Q9EMQ5 | 1057-1218 | None |
| A0A7S2PCH2 | 114-272 | None |
| A0A7S2ICC2 | 172-314 | None |
| A0A7S1MNZ6 | 88-224 | None |
| A0A7S4BNP6 | 95-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.