DPCstruct | MC41789
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 96 ± 16 aa |
| Standard deviation of domain lengths | 16.44 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 34.07 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | PF00228- PF03208 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A199VF33 | 1-94 | MSRSIPKMGASMILLLVVVGHLSFSDQIQAQMPWKCCDNCVCPGSDPLRCGCQDWLSGSCHPNCRKCVKLPLMIYPPYVRCADIILG… |
| P56679 | 8-65 | CCDTCLCTKSNPPTCRCVDVGETCHSACLSCICAYSNPPKCQCFDTQKFCYKACHNSE |
| A0A287JZ83 | 2-70 | None |
| A0A453DSU2 | 47-117 | None |
| A0A453DSU8 | 59-141 | None |
| A0A453DSU0 | 2-120 | None |
| I1HDX7 | 29-141 | None |
| A0A396H375 | 28-153 | None |
| A0A1E5UNT8 | 4-113 | None |
| A0A0E0JDK9 | 219-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.