DPCstruct | MC41785
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 98 ± 11 aa |
| Standard deviation of domain lengths | 11.08 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 21.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07793 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M5U8N2 | 1-98 | MQLPDDDAGLRMVDTLRVGCWVEIQEDEEHKLRCKLTAIVEPTGRYVFVNRTGMKVLEKTRIGLAVEFRRGAVRVLDDALLFDRALE… |
| A0A520YLM1 | 54-159 | SVIKPVRKASETEIEKVLSMKFGTWLYWNKPGEKPQEVKLTWYNSRTQNCMLSNSKGKEIAVVTANVIALGMQDGWIEVLQREKKKP… |
| A0A8B0U2H5 | 355-440 | None |
| A0A7W0JR49 | 511-609 | None |
| A0A523L8Z4 | 1-98 | None |
| A0A2E8J463 | 150-237 | None |
| A0A657B6I3 | 556-664 | None |
| A0A351MD44 | 671-777 | None |
| A0A645HGQ8 | 85-189 | None |
| A0A1N6TC59 | 236-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.