DPCstruct | MC41782
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 142 ± 7 aa |
| Standard deviation of domain lengths | 6.78 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K4W232 | 1-135 | MHEQNVGVVADQYAQYLEQRRAGQPRRFFKTKAQAMYFIQQVAPAKLVDGAWLYGLLPHWADYRFHGLIRTYLEELGDGEQAQNHVS… |
| A0A2H2YW74 | 106-255 | DAVSLDMFLEAERQEVSDGFESYVRRRAAGSPRELFNTKEDAIQWLKRLAPLNLIDGAWLCRVHKITTPFVLRDVTKNAWQVFSEEL… |
| S2KEF0 | 50-186 | None |
| B0KFE6 | 1-150 | None |
| A0A0S4KDU3 | 1-137 | None |
| A0A4T0DBA5 | 109-260 | None |
| A0A1F8AGB5 | 113-250 | None |
| V6AG14 | 344-480 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.