DPCstruct | MC41780
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 79 ± 6 aa |
| Standard deviation of domain lengths | 5.72 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 27.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z9JHF3 | 68-145 | FLERDSWWDTVVSYVSDQSMVTTGGILRYAISLDLDKINNGHQRRVGRVMRALGWENTSRKINGKSTRVWGRPRDSEQ |
| A0A2P8WAJ2 | 240-311 | GDPWFGTIRSYLQKTSREEITVVEILTYALGIQMGMQGRPHEMRVGNVLKMLGWTKTDRRLDDSGVRRRIWV |
| A0A1Z9AXB4 | 652-724 | None |
| K9Q2E5 | 682-761 | None |
| A0A1E4QRY7 | 2-90 | None |
| A0A6N7Q5K4 | 500-581 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.