DPCstruct | MC4178
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 93 ± 8 aa |
| Standard deviation of domain lengths | 7.72 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4Q175 | 429-518 | PRAPGVGPADAVPDRSLREGDPVRVWSVSRGRWIDDGVVQAVAMEDIEVEGQQLVAGSVLVTYDGAAGVKWVHPGEMLDVLSRPEEP… |
| A0A813K7R8 | 45-129 | GAFPSSPQGASARAGGPSFARGENIESWSESRQQWLPGIVQAVFATACSSEGFAVPAGSLKVISETGEKWVMPADVGRILRKVAS |
| A0A813D4F1 | 66-173 | None |
| A0A813KAV8 | 267-365 | None |
| A0A812K7V4 | 52-144 | None |
| A0A516AFV2 | 1116-1222 | None |
| A0A812S6D4 | 3-89 | None |
| A0A7S1RNF8 | 123-214 | None |
| A0A7S1A4V5 | 68-152 | None |
| A0A812WEE1 | 10-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.