DPCstruct | MC41777
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 69 ± 8 aa |
| Standard deviation of domain lengths | 7.95 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 40.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0052 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1PTS9 | 150-225 | PANGTYPFGALGHRSHGGTDMKLTNSAMFRAMQFVAISGPTYDQFAPFQWSTSDFKDNTPHMGHPDTFKFGPVVFD |
| A0A814WBD7 | 1-67 | MLNSAQIYVIISYEMMQKCSLVAIAGPTTDQQPPFIWSKSDFDKKVSHIGHPDKWDFKPYTPTWTLS |
| A0A820FEH2 | 1-58 | None |
| A0A0N5AVC0 | 1-50 | None |
| A0A0B1SQL5 | 100-170 | None |
| A0A131YFR6 | 65-128 | None |
| A0A6J3CBJ5 | 29-98 | None |
| A0A0M3IS46 | 200-279 | None |
| A0A5S6QFS7 | 424-490 | None |
| A7S118 | 127-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.