DPCstruct | MC41776
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 145 ± 12 aa |
| Standard deviation of domain lengths | 12.09 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 24.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A814VNT9 | 6-146 | SVDRVMLTNFCRSLTNDLSILLDAAAIAQLNQMHEVIQGWMREYNFDPQDPSVKVLLAGPRPARENCIQTTYFERLLGDERKRNIIY… |
| A0A814FUC1 | 361-513 | KLLRKEMDKKGSIDRKMLNNFCQSLTHDLTILLDAAAIAQLNKMHEIIQDWMREYNFDPKDPSLKVLIIGPRAAREKNLHTTYFERL… |
| A0A814VB21 | 68-205 | None |
| A0A378I5C3 | 128-276 | None |
| A0A0W0ST89 | 1-155 | None |
| A0A0W0VEY3 | 72-214 | None |
| A0A849MUH1 | 170-320 | None |
| A0A225DCD4 | 3-116 | None |
| A0A0K1EDT3 | 140-290 | None |
| A0A821FS26 | 14-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.