DPCstruct | MC41775
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 95 ± 7 aa |
| Standard deviation of domain lengths | 7.25 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 49.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A814TP54 | 54-163 | DSRTLILKKLDMYYRTIKRQILAFQSLTTGLFLNHLGHEKHIANVVENVFCATAVWSLRQCYCKIDNDQGRAHELGQAAVKCMRGIL… |
| A0A341BYI9 | 10-101 | RLDGYARLVHQTILCHQNPVTGLLPASYDQKDAWVRDNVYSILAVWGLGLAYRKNADRDEDKAKAYELEQSVVKLMRGLLHCMIRQV… |
| A0A5J4NV47 | 14-107 | None |
| Q8BLC1 | 8-99 | None |
| S4RAV3 | 2-85 | None |
| A0A816VXJ1 | 25-139 | None |
| A0A3Q0J1U1 | 19-106 | None |
| A0A667ZLG9 | 6-89 | None |
| A0A067RWI8 | 1-100 | None |
| A0A5C6NLX5 | 111-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.