DPCstruct | MC41774
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 74 ± 9 aa |
| Standard deviation of domain lengths | 8.50 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 32.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0671 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W9NFZ6 | 13-82 | RELNEEVNRLETELKRRLPIGWSTSLSTLRREMVEGKGYSEQALSRALMILQRRDIIMFRNQGAQVYRNG |
| A0A814TJE7 | 6-86 | KRLISGIEGFTTREDQEEISRVEKQIRRRFVVGSQVSEHAIVQDFIRQNYSERTIYKVLHAMVRRGDVQYRMQRKVLIRVR |
| A0A0V0X0M3 | 669-743 | None |
| A0A5N5QK15 | 681-748 | None |
| R1DI08 | 380-473 | None |
| A0A814M7X9 | 601-668 | None |
| R1GEX3 | 875-952 | None |
| E4XIH1 | 1-63 | None |
| A0A7S2FN56 | 50-122 | None |
| A0A059LC45 | 38-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.