DPCstruct | MC41773
Metacluster Properties and Pfam Annotations
| Number of structural domains | 114 |
|---|---|
| Mean domain length (aa) | 229 ± 47 aa |
| Standard deviation of domain lengths | 47.06 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 23.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01975 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848WXN4 | 20-236 | ALKQAVADRFDEIWVVAPAEEASQVGHRVTTHGEIGVKQLDDRQFAITGTPADCTRLALAELLPKRPDLVISGINFGGNLGRHDFVI… |
| A0A0S7DXH1 | 33-283 | QFYNALSAAGHSVVVSAPAENQSGTGSSDKTPTTLTEPCEFSSCPSGSPATGFNASDPRLNYVNSYPVTSMKYGISTAAPPFFNGAR… |
| A0A084RXS5 | 39-184 | None |
| A0A6S7NN37 | 19-299 | None |
| A0A7Y8VQ46 | 29-278 | None |
| A0A6L8JEP6 | 108-353 | None |
| A0A382LU34 | 1-150 | None |
| M1A158 | 35-229 | None |
| A0A849TDX6 | 2-163 | None |
| R7QLR4 | 139-455 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.