DPCstruct | MC4177
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 102 ± 12 aa |
| Standard deviation of domain lengths | 12.24 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J0CUX5 | 88-179 | SDEIMQCLQHECHECEKDAEAAGGKLFRCRTCAAAWCQECLALDTEWSAVGNSIPEFKLLGYSKKRDASFIVCGYCKEVFTKDPGYL… |
| A0A7S3HI52 | 1-112 | MWSCPHHAGCVTCGRRGAAAGFLFRCEMCPNSYCEDCLPAEHHFVGVCERWAELGYATPGSSCFIHCSTGCAKFALEQENHTANETA… |
| A0A7S0QTR8 | 673-792 | None |
| A0A7S3ZCY7 | 76-208 | None |
| W7U140 | 1017-1111 | None |
| A0A1L9TRL9 | 991-1083 | None |
| A0A3M6W9K7 | 552-641 | None |
| S8DTZ1 | 215-309 | None |
| A0A1L9SUV2 | 679-770 | None |
| A0A7S2W6H9 | 114-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.