DPCstruct | MC41766
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 94 ± 10 aa |
| Standard deviation of domain lengths | 10.17 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 66.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0270 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446PMG2 | 1-81 | MVAYALKSEGGYVWACKNYDGDVQSDLVAQGFGSLGLMTSVLVCPDGRTVEAEAAHGTVTRHYRVHQKGGETSTNSIASIF |
| A0A7J6RCH3 | 1-94 | ELGIWYEHRLIDDMVAQAIKSSGGFVWACKNYDGDVQSDIVAQGYGSLGMMTSVLVCPDGKTIEAEAAHGTVTRHYRQHQKGMKTST… |
| A0A3Q8UC38 | 166-266 | None |
| S9YG01 | 252-352 | None |
| A0A3Q8UCA1 | 1-90 | None |
| A0A498N4I9 | 276-376 | None |
| A0A7J7L9J2 | 100-193 | None |
| A0A3Q8UC45 | 55-145 | None |
| F0VNC8 | 341-441 | None |
| A0A813JWQ6 | 369-476 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.