DPCstruct | MC41764
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 192 ± 40 aa |
| Standard deviation of domain lengths | 39.89 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446PI77 | 1-278 | MDSENLHGALSENKVTSALMSIRKALEEQIEESSSRELCILTTLACSEPPLLEETLNRIKVIRELELHGVDDGRRKLYPSAEESLKH… |
| A0A4E9FQD3 | 5-186 | KVQKVCTTIREHILSLDDIHITDLYTTVILTYLKEQPPQVSKALLALREQSLKLPHGKELEKKWIAYVSLLAPTENLFNVALSTYDL… |
| E9G9I7 | 7-169 | None |
| A0A0C9WJQ8 | 486-639 | None |
| A0A0B1SQ22 | 59-228 | None |
| A0A428NXR3 | 32-207 | None |
| A0A058Z1A5 | 228-509 | None |
| J9F7E9 | 204-373 | None |
| A0A820ZYA1 | 146-324 | None |
| Q5KF87 | 680-846 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.