DPCstruct | MC41763
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 177 ± 11 aa |
| Standard deviation of domain lengths | 11.20 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 78.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 46.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6H2Q1 | 649-827 | PKNELNISMLWCLLVVIFCFRILISQAAVYFKSEEGGERILCVTFGFFFLVLAMGILVIDEKILEFGLEPGYQNFSEGAESFLKQQG… |
| B7Z2B1 | 1-199 | MKPTQEMNISLVWCLLVLSFAIKVLFSLTTHYFKVEDGGERSVCVTFGFFFFVKAMAVLIVTENYLEFGLETGFTNFSDSAMQFLEK… |
| A0A2K5XX05 | 1-177 | None |
| A0A6I9WK59 | 2-165 | None |
| A0A287AA40 | 1-177 | None |
| A0A667GW01 | 196-372 | None |
| A0A2S2QGK9 | 130-308 | None |
| A0A504XUJ7 | 151-343 | None |
| A0A158QK35 | 95-258 | None |
| A0A226N296 | 158-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.