DPCstruct | MC41761
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 228 ± 41 aa |
| Standard deviation of domain lengths | 40.50 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 17.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0732 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W5MQ85 | 24-268 | SDGCMELHLRCFLEECEKVLILLKSKVLQTEIRIMNALLYVFHHRLRQHKPYRAFKQVEQCVNRLQNMRLEAAFQDIKEMCPKKFEK… |
| A0A024U8H5 | 3-181 | MDLDEVNGHIESCVEAMDALHAELNVLRKIIYKNTNQHRRANYFQYLVHVKRLHRAVKPDKTKHTIKSILQVLDALKVKDASMHHVS… |
| A0A182IV09 | 6-256 | None |
| A0A446UEW3 | 11-176 | None |
| A0A1Y1VWJ7 | 38-270 | None |
| D7KZ57 | 2-183 | None |
| A0A0R3TMU7 | 24-249 | None |
| A0A1S3IJH7 | 10-271 | None |
| A0A1Y2G454 | 11-292 | None |
| F4S5R3 | 8-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.